PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN22224.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 556aa    MW: 62359.7 Da    PI: 5.5003
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN22224.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.7e-093153521954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +e+  LA+++gLt +qV +WF N R +
  KHN22224.1 315 FEHflHPYPKDSEKIMLARQTGLTRNQVANWFINARVR 352
                 665559******************************88 PP

2BELL126.41e-40186257172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 erq+l  kk+kLls+l+eVdkrY+qy++q+q+v+ssF++vag+g+a+pYt+lAl++iSrhFrcL+dai++qi
  KHN22224.1 186 ERQNLLDKKTKLLSMLDEVDKRYRQYCHQMQIVVSSFDMVAGCGAAEPYTTLALRTISRHFRCLRDAISGQI 257
                 6899999****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-61108255IPR006563POX domain
PfamPF075261.8E-50114254IPR006563POX domain
PROSITE profilePS5007112.438293356IPR001356Homeobox domain
CDDcd000864.13E-12296357No hitNo description
SMARTSM003891.6E-9296360IPR001356Homeobox domain
SuperFamilySSF466891.88E-17297363IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-28299362IPR009057Homeodomain-like
PfamPF059202.6E-17313352IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MADSEQNVNC QGLSLSLGTL MPSNASVSPF QYQYHDTGLL PLMNDYPNPK GAMPLKNDEG  60
NNLHREFRSA ECMASVSSGG FLDMVKKECF YNPHDPSMCL KEVPSDLPGY SNSILNSQYL  120
KAAQDLLDEI VSVRKALKQS GMEKQENTGL DGSKDSDGKS TSQSMQMSSG PNGSTANASS  180
ELSSAERQNL LDKKTKLLSM LDEVDKRYRQ YCHQMQIVVS SFDMVAGCGA AEPYTTLALR  240
TISRHFRCLR DAISGQIQVT QRSLGEQEGI PRLRYVDQQL RQQKALQQLG VMRQAWRPQR  300
GLPESSVSIL RAWLFEHFLH PYPKDSEKIM LARQTGLTRN QVANWFINAR VRLWKPMVEE  360
MYKEEFGDSE MNCNLSSENN TVKCKKDDLV QESDNINNNN KWEETQDNLV TVDSVQVQPQ  420
AELDRGVNVE NVVMDSGTGK LQGDQNQQRL GMNNNNNFYS ISTNQNDGGL MGCSTHATYD  480
LSELGNFTVG SHVSLALELR NCESDGFAMS DDAIRKRRNQ ALASSPETDL LDYHFTDSGK  540
QQHRFGNPHL LHEFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A2e-16302360563Homeobox protein Meis2
4xrm_B2e-16302360563Homeobox protein Meis2
4xrs_A2e-16302359158Homeobox protein Meis1
4xrs_B2e-16302359158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003527678.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_006581186.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_014632704.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_014632703.10.0PREDICTED: BEL1-like homeodomain protein 7
SwissprotQ9FWS91e-116BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLA0A0B2QQ100.0A0A0B2QQ10_GLYSO; BEL1-like homeodomain protein 3
STRINGGLYMA06G03200.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21463179
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.21e-106BEL1-like homeodomain 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]